PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000184989
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 844aa    MW: 95992.9 Da    PI: 6.8126
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000184989genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.48.8e-10429474146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++WT+ Ed+ l+  v++ G ++W  Ia  +g++Rt+ qc  r+q 
    MDP0000184989 429 RKSWTAKEDKNLLYFVQEKGINNWFDIAVSLGTNRTPFQCLARYQR 474
                      789*****************************************96 PP

2Myb_DNA-binding452.5e-14483526246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        WT++Ed +l  av+ lG g+W +Ia+ +g gR + qc +rw k
    MDP0000184989 483 REWTKDEDARLRSAVETLGEGNWQAIASALG-GRAGTQCSNRWKK 526
                      68*****************************.***********98 PP

3Myb_DNA-binding42.61.4e-13536579246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      grWT+eEd+ l+ a  ++G+++W++ a+ ++ gRt  qc++r+ +
    MDP0000184989 536 GRWTPEEDKCLKVAQMLFGPKNWNKTAQFVP-GRTQSQCRDRYVN 579
                      8******************************.***********77 PP

4Myb_DNA-binding35.52.4e-11588627243
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      g W +eEd +l  a++++G   W+++a++++ +Rt+++c  r
    MDP0000184989 588 GEWAEEEDSRLRAAIEEHGYC-WSKVAACVP-RRTDNMCWRR 627
                      68*****************99.*********.*******666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.9E-4328425IPR001005SANT/Myb domain
PROSITE profilePS500905.97329423IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.4E-11331347IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-11396436IPR009057Homeodomain-like
SuperFamilySSF466895.14E-16405472IPR009057Homeodomain-like
PROSITE profilePS500909.466424476IPR017877Myb-like domain
SMARTSM007171.9E-9428478IPR001005SANT/Myb domain
PfamPF002491.2E-7429474IPR001005SANT/Myb domain
CDDcd001676.66E-7431476No hitNo description
Gene3DG3DSA:1.10.10.603.1E-13437487IPR009057Homeodomain-like
SuperFamilySSF466891.6E-19461534IPR009057Homeodomain-like
PROSITE profilePS5129421.693477532IPR017930Myb domain
SMARTSM007175.0E-13481530IPR001005SANT/Myb domain
PfamPF002494.0E-13483526IPR001005SANT/Myb domain
CDDcd001671.90E-10484528No hitNo description
Gene3DG3DSA:1.10.10.601.7E-16488530IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-17532584IPR009057Homeodomain-like
PROSITE profilePS512949.721533581IPR017930Myb domain
SuperFamilySSF466892.59E-22533627IPR009057Homeodomain-like
SMARTSM007175.1E-12534583IPR001005SANT/Myb domain
PfamPF002499.2E-13536579IPR001005SANT/Myb domain
CDDcd001672.76E-10537581No hitNo description
PROSITE profilePS5129417.056582636IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-14585627IPR009057Homeodomain-like
SMARTSM007173.0E-9586634IPR001005SANT/Myb domain
PfamPF002491.2E-9588627IPR001005SANT/Myb domain
CDDcd001671.59E-7589631No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 844 aa     Download sequence    Send to blast
MSPPSDDDQD QFSVDEEEED DDLFEADMEA LRRACMLTGT SPDDLKNDGG XGNDDERQAS  60
ADSESDSDXD ADDDDLELLR QIRSRFSNSS DACEPLSLKP LCTLPPDASG DEEDDYQTLL  120
AIRKRFSAYG NDTLENDTKQ VGSCCKSVKE TCYEISAIRN DALERFPDPE DADLATXPLS  180
DNAEGQSSAL IVWNQSDSCS TSMLPRKDSS FPKAAQVFMD AIKKNRASQK FIRNKLIQIE  240
AKIEENRKXK ERVKILKDFQ VSCKRRTWES XSQKKDPRVQ LILPKGPRDS RDSKVHYKKI  300
SALLYGPEEN SHVANYRMTM KKYLDSLCRK KWSKVEKEAL EKGIKQQFQE MVLQSSVDES  360
SFSERPCGES NHIDDILASI KGLEITPEII REFLPKVKWE QLASMYLPGR SGAECETRWL  420
NWEDPLINRK SWTAKEDKNL LYFVQEKGIN NWFDIAVSLG TNRTPFQCLA RYQRSLNASI  480
LKREWTKDED ARLRSAVETL GEGNWQAIAS ALGGRAGTQC SNRWKKSLHP TKKREGRWTP  540
EEDKCLKVAQ MLFGPKNWNK TAQFVPGRTQ SQCRDRYVNS LEPSLNYGEW AEEEDSRLRA  600
AIEEHGYCWS KVAACVPRRT DNMCWRRCKV LYPEEVLLLK EQKKIKKVAL MCNFVDREEE  660
RPALGPNDFL PPIDTSTKTL TYPKKQNGKL SKVPNKTRSX RNKNNSESCS DAHGIDNSDQ  720
VETSNGHDAP NKKNNVRKQR RRRRKSTEPT GEGQVIVPVP DEHVTHKEEQ RETSCSDQIV  780
GTSDGDDTTL AVFQRNKSKK RNLGPPSNDT RKKRKLVVSD CSVQDSPTNN IQKGAGSHPE  840
AAIM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-263996222155MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-263996222155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1736744RKQRRRRRK
2798814KKRNLGPPSNDTRKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360099.10.0PREDICTED: uncharacterized protein LOC103950593
TrEMBLM5WEG40.0M5WEG4_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1